General Information

  • ID:  hor005790
  • Uniprot ID:  P15513
  • Protein name:  Myomodulin H
  • Gene name:  MYOMOD1
  • Organism:  Aplysia californica (California sea hare)
  • Family:  NA
  • Source:  Animal
  • Expression:  Expressed in all ganglia of the CNS, but only in a subset of neurons including L10 in the abdominal ganglion and B16 in the buccal ganglion.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Aplysia (genus), Aplysiidae (family), Aplysioidea (superfamily), Aplysiida (order), Tectipleura, Euthyneura, Heterobranchia (subclass), Gastropoda (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GLHMLRL
  • Length:  7(63-69)
  • Propeptide:  MQVYMLLPLAVFASLTYQGACEETAAAQTSSDASTSSASSEHAENELSRAKRGSYRMMRLGRGLHMLRLGKRGGPVEPESEENLETLLNLLQGYYSDVPEYPSEFDDTDLAYPYEEYDAPAHPRYRRSTPPTDGVVAPDVLQKGSSEFEDFGDSQLDESDEGYYGYDPENYLYGDFEDYLEPEEGGLGEEKRSLSMLRLGKRGLSMLRLGKREGEEGDEMDKKQDESLNDDFENDDIKRTLSMLRLGKRPMSMLR
  • Signal peptide:  MQVYMLLPLAVFASLTYQ
  • Modification:  T7 Leucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Exogenous application of myomodulins potentiates ARC muscle contraction.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P15513-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005790_AF2.pdbhor005790_ESM.pdb

Physical Information

Mass: 94628 Formula: C37H66N12O8S
Absent amino acids: ACDEFIKNPQSTVWY Common amino acids: L
pI: 10.55 Basic residues: 2
Polar residues: 1 Hydrophobic residues: 3
Hydrophobicity: 74.29 Boman Index: -153
Half-Life / Aliphatic Index: 30 hour Aliphatic Index: 167.14
Instability Index: 3608.57 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  8422272
  • Title:  Molecular cloning of myomodulin cDNA, a neuropeptide precursor gene expressed in neuron L10 of Aplysia californica.
  • PubMed ID:  8340812
  • Title:  The myomodulin-related neuropeptides: characterization of a gene encoding a family of peptide cotransmitters in Aplysia.
  • PubMed ID:  1788132
  • Title:  Structure, bioac
  • PubMed ID:  7472354
  • Title:  
  • PubMed ID:  3474664
  • Title: